PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG035212t1
Common NameTCM_035212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24432.9 Da    PI: 9.0626
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG035212t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.9e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien+snrqvt+skRrngi+KKA+E+ vLCda+v++iif+s+gk++ey+s
  Thecc1EG035212t1  9 KRIENSSNRQVTYSKRRNGIMKKAKEITVLCDARVSLIIFASSGKMHEYCS 59
                      79***********************************************96 PP

2K-box86.36.3e-2971167197
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       y+k+sgk+l++ak+e+l++e++++kke++++  e+Rhl+Ged++sL++keL+ +e++Le++l  +R+k++++l    +++++ e+++++ n  
  Thecc1EG035212t1  71 YHKTSGKRLWDAKHENLSNEIDRIKKENDSMHIELRHLKGEDITSLQYKELMAIEDALENGLACVRAKQMDVLDVTRKNTKMLEEDNKQLNFI 163
                       7999***************************************************************************************98 PP

             K-box  94 Lrkk 97 
                        +++
  Thecc1EG035212t1 164 VNQQ 167
                       8877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.422161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-36296IPR002100Transcription factor, MADS-box
CDDcd002653.41E-42280No hitNo description
PRINTSPR004041.4E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-1882161IPR002487Transcription factor, K-box
PROSITE profilePS5129713.83784170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGIMK KAKEITVLCD ARVSLIIFAS SGKMHEYCSP  60
STNLIDILDQ YHKTSGKRLW DAKHENLSNE IDRIKKENDS MHIELRHLKG EDITSLQYKE  120
LMAIEDALEN GLACVRAKQM DVLDVTRKNT KMLEEDNKQL NFIVNQQHIA YENAREQMDN  180
GYQRARDYNS QIPFAFRVQP MQPNLQERM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-17289180Myocyte-specific enhancer factor 2A
3kov_B5e-17289180Myocyte-specific enhancer factor 2A
3kov_I5e-17289180Myocyte-specific enhancer factor 2A
3kov_J5e-17289180Myocyte-specific enhancer factor 2A
3mu6_A5e-17271168Myocyte-specific enhancer factor 2A
3mu6_B5e-17271168Myocyte-specific enhancer factor 2A
3mu6_C5e-17271168Myocyte-specific enhancer factor 2A
3mu6_D5e-17271168Myocyte-specific enhancer factor 2A
3p57_A5e-17289180Myocyte-specific enhancer factor 2A
3p57_B5e-17289180Myocyte-specific enhancer factor 2A
3p57_C5e-17289180Myocyte-specific enhancer factor 2A
3p57_D5e-17289180Myocyte-specific enhancer factor 2A
3p57_I5e-17289180Myocyte-specific enhancer factor 2A
3p57_J5e-17289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019220.11e-156Mads box protein, putative
SwissprotQ033781e-106GLOB_ANTMA; Floral homeotic protein GLOBOSA
TrEMBLA0A061FGH91e-156A0A061FGH9_THECC; Mads box protein, putative
STRINGVIT_18s0001g01760.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-92MIKC_MADS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]